DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and gsto1

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:248 Identity:90/248 - (36%)
Similarity:136/248 - (54%) Gaps:15/248 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MALPQKHFKRGSTKP-ELPEDGVPRFFSMAFCPFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKD 64
            ||..||...:||..| .:|:|.: |.:||.||||:.|.||:|.||.|::..|.::|..||:|:.:
Zfish     1 MAASQKCLGKGSPAPGPVPKDHI-RLYSMRFCPFAQRTRLVLNAKGIKYDTININLKNKPDWFLE 64

  Fly    65 FSPLGKVPALQLTGVKDQPTLVESLIIAEYLDQQYPQTRLFPTDPLQKALDKILIERFAPVVSAI 129
            .:|||.||.|:   .:....:.||.|..||||:.||:.:|.|.||.::|..::|:|.|:.|....
Zfish    65 KNPLGLVPVLE---TQSGQVIYESPITCEYLDEVYPEKKLLPFDPFERAQQRMLLELFSKVTPYF 126

  Fly   130 YPVLTCNPNAPKDAI---PNFENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKIN 191
            |.: ..|....:|..   ...::.|..|...|.|:.:.:|.|..|.::|||:||||||..:|.: 
Zfish   127 YKI-PVNRTKGEDVSALETELKDKLSQFNEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNL- 189

  Fly   192 TEQKYELDTKRFEKLLKWRDLMTQDEVVQKTALDVQLHAEFQKSKTLGNPQYD 244
               |:.||..  .:|.||.:.|.:|..|:.|....:.:..|.||...|||.||
Zfish   190 ---KHCLDGT--PELKKWTERMMEDPTVKATMFSTETYMVFYKSYMEGNPNYD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 37/91 (41%)
GstA 25..215 CDD:223698 69/192 (36%)
GST_C_Omega 110..235 CDD:198293 36/127 (28%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 37/92 (40%)
GstA 25..210 CDD:223698 69/194 (36%)
GST_C_Omega 107..229 CDD:198293 37/128 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11791
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3986
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm6382
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.870

Return to query results.
Submit another query.