DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstD9

DIOPT Version :10

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_650181.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:202 Identity:48/202 - (23%)
Similarity:86/202 - (42%) Gaps:33/202 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FFSMAFCPFSHRVRLMLAAKHIEHHKIYVDLIE----KPEWYKDFSPLGKVPALQLTGVKDQPTL 85
            |:.|.:......:.:...|..:|.:|..|||..    |||:.| .:|...:|.|    |.|...:
  Fly     4 FYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVK-INPQHTIPTL----VDDGFAI 63

  Fly    86 VESLIIAEYLDQQYPQT-RLFPTDPLQKALDKILIER--------FAPVVSAIYPVLTCNPNAPK 141
            .||..|..||.::|.:. .|:|.||.|:|   ::.:|        :...|...||.|..:...|.
  Fly    64 WESRAILIYLAEKYDKDGSLYPKDPQQRA---VINQRLFFDLSTLYQSYVYYYYPQLFEDVKKPA 125

  Fly   142 DA--IPNFENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFE 204
            |.  :...::|..:|...|  :|..|.|...:.:.|:.:        ...::|.:..|.|..::.
  Fly   126 DPDNLKKIDDAFAMFNTLL--KGQQYAALNKLTLADFAL--------LATVSTFEISEYDFGKYP 180

  Fly   205 KLLKWRD 211
            ::::|.|
  Fly   181 EVVRWYD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 5..96 CDD:469754 21/74 (28%)
GST_C_Omega 110..235 CDD:198293 21/112 (19%)
GstD9NP_650181.1 GstA 1..187 CDD:440390 47/200 (24%)

Return to query results.
Submit another query.