DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstZ2

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:187 Identity:43/187 - (22%)
Similarity:81/187 - (43%) Gaps:27/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 SHRVRLMLAAKHIEHHKIYVDLIEKP-----EWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAE 93
            |.|||:.:..|.|.:....:.||:..     ..|::.:|:.:|||||:.|    .||:||:.|..
  Fly    27 SWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQIDG----HTLIESVAIMH 87

  Fly    94 YLDQQYPQTRLFPTDPLQKALDKILIERFAPVVSAIYP------VLTCNPNAPKDAIPNF-ENAL 151
            ||::..||..|.|.|..::|..:.::|   .:.|.|.|      ::.......|:...:: ....
  Fly    88 YLEETRPQRPLLPQDVHKRAKVREIVE---IICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGF 149

  Fly   152 DVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLK 208
            ...|..|......|..|..|.:.|..:.|        ::...:::.:|.:.:..:|:
  Fly   150 RAVEKALSTSAGKYCVGDEISMADCCLVP--------QVFNARRFHVDLRPYPIILR 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 22/66 (33%)
GstA 25..215 CDD:223698 43/187 (23%)
GST_C_Omega 110..235 CDD:198293 15/106 (14%)
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 22/66 (33%)
maiA 17..221 CDD:273527 43/187 (23%)
GST_C_Zeta 104..217 CDD:198300 15/106 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.