DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and gfzf

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster


Alignment Length:216 Identity:55/216 - (25%)
Similarity:98/216 - (45%) Gaps:44/216 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RFFSMAFCPFSHRVRLMLAAKHIEHHKIYVD---LIEKPEWYKDFSPLGKVPALQLTGVKDQPTL 85
            :.::::..|.|..||:.|.|..|::..|.||   :..:.|.|...:|..::|.|...|.    .|
  Fly   813 KLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGF----YL 873

  Fly    86 VESLIIAEYLDQQY-PQTRLFPTDPLQKALDKILIER--------FAPV-VSAIYPVLTCNPNAP 140
            .||:.|.:||..:| |.:.|:|.|...:|   ::.:|        :||: ..::.|:.......|
  Fly   874 SESIAIMQYLCDKYAPDSTLYPQDVNVRA---VINQRLCFNMGFYYAPISAHSMAPIFFDYKRTP 935

  Fly   141 KDAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDY--------------------MIWPWFERF 185
            . ::...:|||||||..|.:.||.|.||::|.|.|:                    ::..|:|.|
  Fly   936 M-SLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWYETF 999

  Fly   186 PSMKINTEQKYELDTKRFEKL 206
               |:...|.:|:.....:::
  Fly  1000 ---KVEYPQLWEIANSGMQEI 1017

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 21/74 (28%)
GstA 25..215 CDD:223698 55/215 (26%)
GST_C_Omega 110..235 CDD:198293 28/126 (22%)
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 22/76 (29%)
GstA 812..1000 CDD:223698 52/197 (26%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 28/123 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5020
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.