DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstO1

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:243 Identity:113/243 - (46%)
Similarity:157/243 - (64%) Gaps:3/243 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KHFKRGSTKPELPEDGVPRFFSMAFCPFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPLGK 70
            :|...||.||..|:||:.:.:||.|||::|||.|:|.||.|.:|.||::|.:||||:...|...|
  Fly     5 QHLTIGSPKPVFPDDGILKLYSMRFCPYAHRVHLVLDAKKIPYHAIYINLRDKPEWFSLVSSSTK 69

  Fly    71 VPALQLTGVKDQPTLVESLIIAEYLDQQYPQTRLFPTDPLQKALDKILIERFAPVVSAIYPVLT- 134
            ||||:|...:..|.|:|||||.:|||::||:..|:|.|.|:||.:|||||||...::|.|.:|. 
  Fly    70 VPALELVKEQGNPVLIESLIICDYLDEKYPEVPLYPKDLLKKAQEKILIERFGQFINAFYYLLLH 134

  Fly   135 CNPNAPKDAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELD 199
            .||....|.  :....|.|:|.||.:|.|.:|.|...|::|||:|||.|||.|:|...|||:||.
  Fly   135 DNPEQLVDT--DHYAGLVVYEEELKRRCTKFFGGDSPGMLDYMMWPWCERFDSLKYTFEQKFELS 197

  Fly   200 TKRFEKLLKWRDLMTQDEVVQKTALDVQLHAEFQKSKTLGNPQYDIAF 247
            .:||..|:||||||.||..|:...||.|.||::..|:..|...|::.:
  Fly   198 PERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRRSGQADYNMLY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 44/89 (49%)
GstA 25..215 CDD:223698 94/190 (49%)
GST_C_Omega 110..235 CDD:198293 59/125 (47%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 44/89 (49%)
GstA 22..216 CDD:223698 96/195 (49%)
GST_C_Omega 109..234 CDD:198293 59/126 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449074
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 1 0.900 - - E1_KOG0406
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3986
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm6382
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - P PTHR43968
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X130
1211.810

Return to query results.
Submit another query.