DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstE8

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001286571.1 Gene:GstE8 / 37113 FlyBaseID:FBgn0063492 Length:222 Species:Drosophila melanogaster


Alignment Length:206 Identity:45/206 - (21%)
Similarity:88/206 - (42%) Gaps:32/206 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RLMLAAKHIEHHKIYVDLIEK----PEWYKDFSPLGKVPALQLTGVKDQPTLVESLIIAEYLDQQ 98
            :|.|||..|.:..:.::.:.|    ||:.:. :|...||.|:    .|...:.:|..|:.||..:
  Fly    19 KLTLAALGIPYEYVKINTLAKETLSPEFLRK-NPQHTVPTLE----DDGHFIWDSHAISAYLVSK 78

  Fly    99 YPQT-RLFPTDPLQKAL--DKILIERFAPVVSAIYPV-----LTCNPNAPKDAIPNFENALDVFE 155
            |.|: .|:|.|.||:|:  .::..|.....|:.:..:     .|.....||:   .::..:::::
  Fly    79 YGQSDTLYPKDLLQRAVVDQRLHFESGVVFVNGLRGITKPLFATGQTTIPKE---RYDAVIEIYD 140

  Fly   156 -VELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKW----RDLMTQ 215
             ||....|..:.||..:.|.|:.:...........:       :||.::..:..|    .:|...
  Fly   141 FVETFLTGHDFIAGDQLTIADFSLITSITALAVFVV-------IDTVKYANITAWIKRIEELPYY 198

  Fly   216 DEVVQKTALDV 226
            :|...|.|.|:
  Fly   199 EEACGKGARDL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 16/61 (26%)
GstA 25..215 CDD:223698 41/193 (21%)
GST_C_Omega 110..235 CDD:198293 23/129 (18%)
GstE8NP_001286571.1 GstA 4..196 CDD:223698 40/191 (21%)
GST_N_Delta_Epsilon 4..77 CDD:239343 17/62 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 22/127 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460199
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.