DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstE4

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:217 Identity:58/217 - (26%)
Similarity:91/217 - (41%) Gaps:39/217 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LMLAAKHIEHHKIYVDLIEKPEWYKDFS---PLGKVPALQLTGVKDQPTLVESLIIAEYLDQQY- 99
            |.|.|..:....::|:|.||..:.:|||   |...||.||    .|...:.:|..|..||.::| 
  Fly    20 LTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQ----DDDACIWDSHAIMAYLVEKYA 80

  Fly   100 PQTRLFPTDPLQKA-LDKIL-IERFAPVVSAI----YPVLTC-NPNAPKDAIPNFENALDVFEVE 157
            |...|:|.|.||:| :|::: .|......||:    .|||.. .|..|::.:.:.....|..|..
  Fly    81 PSDELYPKDLLQRAKVDQLMHFESGVIFESALRRLTRPVLFFGEPTLPRNQVDHILQVYDFVETF 145

  Fly   158 LGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQK----YELDTKRFEKLLKW----RDLMT 214
            |...  .:.||..:.|.|:.|           ::|...    .|||..::.|:..|    ::|..
  Fly   146 LDDH--DFVAGDQLTIADFSI-----------VSTITSIGVFLELDPAKYPKIAAWLERLKELPY 197

  Fly   215 QDEVVQKTALDVQLHAEFQKSK 236
            .:|...|.|..   ..|..:||
  Fly   198 YEEANGKGAAQ---FVELLRSK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 19/59 (32%)
GstA 25..215 CDD:223698 52/194 (27%)
GST_C_Omega 110..235 CDD:198293 31/139 (22%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 20/60 (33%)
GstA 6..196 CDD:223698 51/192 (27%)
GST_C_Delta_Epsilon 91..209 CDD:198287 30/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460200
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.