DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstE3

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_611325.2 Gene:GstE3 / 37108 FlyBaseID:FBgn0063497 Length:220 Species:Drosophila melanogaster


Alignment Length:239 Identity:62/239 - (25%)
Similarity:100/239 - (41%) Gaps:55/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DGVPRFFSMAFCPFSHRVRLMLAAKHIEHHKIYVDLIE----KPEWYKDFSPLGKVPALQLTGVK 80
            ||.|...|         |.|.|.|.:::.....|:|:|    |||:.| .:||..||||...|. 
  Fly    10 DGSPPVRS---------VLLTLRALNLDFDYKIVNLMEKEHLKPEFLK-INPLHTVPALDDNGF- 63

  Fly    81 DQPTLVESLIIAEYLDQQYPQT-RLFPTDPLQKALDKILIERFAPVVSA-----IYPVLTCN--- 136
               .|.:|..|..||..:|.:. .|:|.|..::|:....:...:.||::     .:|:...|   
  Fly    64 ---YLADSHAINSYLVSKYGRNDSLYPKDLKKRAIVDQRLHYDSSVVTSTGRAITFPLFWENKTE 125

  Fly   137 -PNAPKDAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDYMI----WPWFERFPSMKINTEQKY 196
             |.|..||:.....:|::| :|.|.    |.||.::.|.|:.:    ..:|...|          
  Fly   126 IPQARIDALEGVYKSLNLF-LENGN----YLAGDNLTIADFHVIAGLTGFFVFLP---------- 175

  Fly   197 ELDTKRFEKLLKW----RDLMTQDEVVQKTALDVQLHAEFQKSK 236
             :|..::.:|..|    ::|...:|.....|..:   .||.|||
  Fly   176 -VDATKYPELAAWIKRIKELPYYEEANGSRAAQI---IEFIKSK 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 26/79 (33%)
GstA 25..215 CDD:223698 52/211 (25%)
GST_C_Omega 110..235 CDD:198293 28/141 (20%)
GstE3NP_611325.2 GstA 4..195 CDD:223698 54/214 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 27/80 (34%)
GST_C_Delta_Epsilon 91..208 CDD:198287 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460201
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.