DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstE1

DIOPT Version :10

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:223 Identity:52/223 - (23%)
Similarity:88/223 - (39%) Gaps:38/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFSHRVRLMLAAKHIEHHKIYVDL---IEKPEWYKDFSPLGKVPALQLTGVKDQPTLV-ESLIIA 92
            |....|:|.|...::::....|:|   ....|.|...:|...||.|.     |..|.: :|..||
  Fly    15 PCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLD-----DNGTFIWDSHAIA 74

  Fly    93 EYLDQQYPQT-RLFPTDPLQKALDKILIERFAPVVSAIYPVL--TCNP-------NAPKDAIPNF 147
            .||..:|.:: .|:|.|..::|   |:.:|.....|.||..:  ...|       ..|::.:...
  Fly    75 AYLVDKYAKSDELYPKDLAKRA---IVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAV 136

  Fly   148 ENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKWRDL 212
            ...|.:.|..||  .:||.||..:.:.|....|.....|:       ..::|...:.|:..|.|.
  Fly   137 HQGLKLLETFLG--NSPYLAGDSLTLADLSTGPTVSAVPA-------AVDIDPATYPKVTAWLDR 192

  Fly   213 MTQ----DEVVQKTALDVQLHAEFQKSK 236
            :.:    .|:.:..|   |.:..|.:||
  Fly   193 LNKLPYYKEINEAPA---QSYVAFLRSK 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 5..96 CDD:469754 18/67 (27%)
GST_C_Omega 110..235 CDD:198293 27/137 (20%)
GstE1NP_611323.1 GstA 6..201 CDD:440390 46/202 (23%)

Return to query results.
Submit another query.