DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstE14

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:184 Identity:37/184 - (20%)
Similarity:73/184 - (39%) Gaps:39/184 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 YVDLIEKPEWYKDF---SPLGKVPALQLTGVKDQPTLVESLIIAEYLDQQYPQ-TRLFPTDPLQ- 111
            :|:|.:..::.|||   :|...||.|    |.....|.:|..|..:|.:::.: ..|:|.:..: 
  Fly    35 FVNLFKGEQFQKDFLALNPQHSVPTL----VHGDLVLTDSHAILIHLAEKFDEGGSLWPQEHAER 95

  Fly   112 -KALDKILIE------RFAPVVSAIYPVLTCNPNAPKDAIPNFENALDVFEVELGK--RGTPYFA 167
             |.|:.:|.|      |.:..:||     |.........:.:.|..|....:.:.:  ..:.:.|
  Fly    96 MKVLNLLLFECSFLFRRDSDFMSA-----TVRQGFANVDVAHHERKLTEAYIIMERYLENSDFMA 155

  Fly   168 GQHIGIVDY----------MIWPWFERFPSMK-----INTEQKYELDTKRFEKL 206
            |..:.:.|.          :::| ..:||.::     :.....||.:....|||
  Fly   156 GPQLTLADLSIVTTLSTVNLMFP-LSQFPRLRRWFTAMQQLDAYEANCSGLEKL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 13/46 (28%)
GstA 25..215 CDD:223698 37/184 (20%)
GST_C_Omega 110..235 CDD:198293 21/122 (17%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 33/174 (19%)
GST_N_Delta_Epsilon 6..79 CDD:239343 14/47 (30%)
GST_C_Delta_Epsilon 94..209 CDD:198287 21/121 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.