Sequence 1: | NP_729388.1 | Gene: | GstO2 / 38974 | FlyBaseID: | FBgn0035906 | Length: | 251 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610509.2 | Gene: | GstT1 / 35995 | FlyBaseID: | FBgn0050000 | Length: | 228 | Species: | Drosophila melanogaster |
Alignment Length: | 257 | Identity: | 52/257 - (20%) |
---|---|---|---|
Similarity: | 85/257 - (33%) | Gaps: | 110/257 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 KIYVDLIEKPE---W--------------------------YKDFSPLGKVPALQLTGVKDQPTL 85
Fly 86 VESLIIAEYL-------DQQYPQTRLFPTDPLQK--ALDKILIERFAPVVSAIYPVLTCN----- 136
Fly 137 --------------PNAPKDAIPNFENALDVFE-VELGKRGTPYFAGQHIGIVDYMIWPWFERFP 186
Fly 187 SMKINTEQ--KYELDTKRFEKLLKWRDLMTQDEVVQKTALDVQLHAEFQKSKTLGNPQYDIA 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstO2 | NP_729388.1 | Thioredoxin_like | 5..96 | CDD:294274 | 17/81 (21%) |
GstA | 25..215 | CDD:223698 | 47/224 (21%) | ||
GST_C_Omega | 110..235 | CDD:198293 | 26/148 (18%) | ||
GstT1 | NP_610509.2 | GstA | 5..204 | CDD:223698 | 47/247 (19%) |
GST_N_Theta | 5..80 | CDD:239348 | 17/77 (22%) | ||
GST_C_Theta | 93..218 | CDD:198292 | 30/159 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45460040 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |