DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstT1

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster


Alignment Length:257 Identity:52/257 - (20%)
Similarity:85/257 - (33%) Gaps:110/257 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KIYVDLIEKPE---W--------------------------YKDFSPLGKVPALQLTGVKDQPTL 85
            |.|.|.:.:|.   |                          |:..:...||||:    |..:..|
  Fly     6 KYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAI----VDGKFQL 66

  Fly    86 VESLIIAEYL-------DQQYPQTRLFPTDPLQK--ALDKILIERFAPVVSAIYPVLTCN----- 136
            .||:.|..||       :|.||:|       |::  .:|:.|..:...|      .|.|:     
  Fly    67 GESVSIVRYLADKGVFSEQLYPKT-------LEERARVDEFLEWQHFNV------RLVCSLFFRQ 118

  Fly   137 --------------PNAPKDAIPNFENALDVFE-VELGKRGTPYFAGQHIGIVDYMIWPWFERFP 186
                          |.:.|..|.:.|:.|.:.| :.|.|   .:..|..:.:.|.        |.
  Fly   119 VWLLPAKGLAPAPKPESVKKLIKDVESNLGLLERLWLEK---DFLVGDKLTVADI--------FG 172

  Fly   187 SMKINTEQ--KYELDTKRFEKLLKWRDLMTQDEVVQKTALDVQLHAEFQKSKTLGNPQYDIA 246
            |.:||..:  :|.::.|:|.|:.||                      .::.:...||.||.|
  Fly   173 SSEINQMKLCQYNVNEKQFPKVAKW----------------------MERVRDATNPYYDEA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 17/81 (21%)
GstA 25..215 CDD:223698 47/224 (21%)
GST_C_Omega 110..235 CDD:198293 26/148 (18%)
GstT1NP_610509.2 GstA 5..204 CDD:223698 47/247 (19%)
GST_N_Theta 5..80 CDD:239348 17/77 (22%)
GST_C_Theta 93..218 CDD:198292 30/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460040
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.