DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstE13

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001188889.1 Gene:GstE13 / 35928 FlyBaseID:FBgn0033381 Length:226 Species:Drosophila melanogaster


Alignment Length:73 Identity:18/73 - (24%)
Similarity:29/73 - (39%) Gaps:15/73 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HKIYVDLIEKPEWYKDFSPLGKVPA---LQLTGVKDQPTLVESLIIAEYLDQQYPQTRLFPTDPL 110
            |..|.||       :.|...|....   |.:..|....|||...::.....::||||:.:     
  Fly   136 HNAYSDL-------EHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQW----- 188

  Fly   111 QKALDKIL 118
            .:.:||:|
  Fly   189 MERMDKLL 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 11/49 (22%)
GstA 25..215 CDD:223698 18/73 (25%)
GST_C_Omega 110..235 CDD:198293 3/9 (33%)
GstE13NP_001188889.1 GST_N_Delta_Epsilon 4..78 CDD:239343
GST_C_Delta_Epsilon 92..211 CDD:198287 18/73 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.