powered by:
Protein Alignment GstO2 and GstE13
DIOPT Version :9
Sequence 1: | NP_729388.1 |
Gene: | GstO2 / 38974 |
FlyBaseID: | FBgn0035906 |
Length: | 251 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001188889.1 |
Gene: | GstE13 / 35928 |
FlyBaseID: | FBgn0033381 |
Length: | 226 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 18/73 - (24%) |
Similarity: | 29/73 - (39%) |
Gaps: | 15/73 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 HKIYVDLIEKPEWYKDFSPLGKVPA---LQLTGVKDQPTLVESLIIAEYLDQQYPQTRLFPTDPL 110
|..|.|| :.|...|.... |.:..|....|||...::.....::||||:.:
Fly 136 HNAYSDL-------EHFLQQGSFVVGNELSVADVSIHTTLVTLDLLIPVEREKYPQTKQW----- 188
Fly 111 QKALDKIL 118
.:.:||:|
Fly 189 MERMDKLL 196
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45460204 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.840 |
|
Return to query results.
Submit another query.