DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GSTT4

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001345593.1 Gene:GSTT4 / 25774 HGNCID:26930 Length:241 Species:Homo sapiens


Alignment Length:225 Identity:52/225 - (23%)
Similarity:98/225 - (43%) Gaps:47/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RVRLMLAAKH-IEHHKIYVDLIE---KPEWYKDFSPLGKVPALQLTGVKD-QPTLVESLIIAEYL 95
            |...:.:.|| |:.:..:|||::   ..:.|.|.:||.|:|:|     || :..|.||..|..||
Human    15 RAVYIFSKKHDIQFNFQFVDLLKGHHHSKGYIDINPLRKLPSL-----KDGKFILSESAAILYYL 74

  Fly    96 DQQY-PQTRLFPTDPLQKA-LDKILIERFA----PVVSAIY-----PVLT---CNPNAPKDAIPN 146
            .::| ..:...|.||..:| :|:.:..:..    |:...::     |.:|   .:....:.|:..
Human    75 CRKYSAPSHWCPPDPHARARVDEFVAWQHTAFQLPMKKIVWLKLLIPKITGEEVSAEKMEHAVEE 139

  Fly   147 FENALDVFEVELGKRGTPYFAGQHIGIVDY-----MIWPWFERFPSMKINTEQ------KYELDT 200
            .:|:|.:|| |...:...:..|..|.:.|.     |:.|....: ::.:|:.:      :.||:.
Human   140 VKNSLQLFE-EYFLQDKMFITGNQISLADLVAVVEMMQPMAANY-NVFLNSSKLAEWRMQVELNI 202

  Fly   201 ---------KRFEKLLKWRDLMTQDEVVQK 221
                     .|..:|..| |..|.|.:|::
Human   203 GSGLFREAHDRLMQLADW-DFSTLDSMVKE 231

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 21/64 (33%)
GstA 25..215 CDD:223698 49/217 (23%)
GST_C_Omega 110..235 CDD:198293 26/145 (18%)
GSTT4NP_001345593.1 Thioredoxin_like 3..78 CDD:320948 22/67 (33%)