DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and gst1

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_588298.1 Gene:gst1 / 2538694 PomBaseID:SPCC191.09c Length:229 Species:Schizosaccharomyces pombe


Alignment Length:200 Identity:43/200 - (21%)
Similarity:66/200 - (33%) Gaps:61/200 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 FSMAFCPFSHRVRLMLAAKHIEHHKIYVDLI----EKPEWYKDFSPLGKVPALQLTGVKDQPTLV 86
            :|.|..|...:|...|....:.:...||:..    :.|| :...:|.|:||.| :....:..|:.
pombe     7 WSHAHGPNPWKVVQALKELDLTYETRYVNFSKNEQKSPE-HLALNPNGRVPTL-IDHHNNDYTIW 69

  Fly    87 ESLIIAEYLDQQYPQTRLFPTDPLQKALDKILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENAL 151
            ||..|..||..:|...|            ||.:.|..|....:...|                  
pombe    70 ESDAILIYLADKYDTER------------KISLPRDHPEYYKVIQYL------------------ 104

  Fly   152 DVFEVELGKRGTPYFAGQHIGIVDYMIW---PWFERF-PSMKINTEQKYELDTKR----FEKLLK 208
                         :|.....||    ||   .||..: ..:.|:...:|..:.||    .|.:||
pombe   105 -------------FFQASGQGI----IWGQAGWFSVYHQELVISAITRYRNEIKRVLGVLEDILK 152

  Fly   209 WRDLM 213
            .||.:
pombe   153 DRDYL 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 19/73 (26%)
GstA 25..215 CDD:223698 43/199 (22%)
GST_C_Omega 110..235 CDD:198293 21/111 (19%)
gst1NP_588298.1 GST_N_Ure2p_like 3..84 CDD:239346 21/78 (27%)
GstA 5..218 CDD:223698 43/199 (22%)
GST_C_Ure2p 96..219 CDD:198326 17/96 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.