DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstE9

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:192 Identity:53/192 - (27%)
Similarity:80/192 - (41%) Gaps:34/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RLMLAAKHIEHHKIYVDLIEKPEWYKDFS---PLGKVPALQLTGVKDQPTLVESLIIAEYLDQQY 99
            :|.|.|..:::....|:|:......|:||   |...||.|:    .|...:.||..|..||.::|
  Fly    19 KLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLE----DDGKFIWESHAICAYLVRRY 79

  Fly   100 PQT-RLFPTDPLQKAL-DKIL-----------IERFAPVVSAIYPVLTCNPNAPKDAIPNFENAL 151
            .:: .|:|.|..::|| |:.|           |...|  :...|..:|..|.:..|||  :| |.
  Fly    80 AKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIA--IPLFYKNITEVPRSQIDAI--YE-AY 139

  Fly   152 DVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKWRDLM 213
            |..|..:|.:.  |..|..|.|.||.:.........:.       .:|.||:.||..|.|.|
  Fly   140 DFLEAFIGNQA--YLCGPVITIADYSVVSSVSSLVGLA-------AIDAKRYPKLNGWLDRM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 17/60 (28%)
GstA 25..215 CDD:223698 53/192 (28%)
GST_C_Omega 110..235 CDD:198293 31/116 (27%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 53/192 (28%)
GST_N_Delta_Epsilon 4..76 CDD:239343 17/60 (28%)
GST_C_Delta_Epsilon 92..209 CDD:198287 31/115 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460202
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.