DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and GstE9

DIOPT Version :10

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:192 Identity:53/192 - (27%)
Similarity:80/192 - (41%) Gaps:34/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RLMLAAKHIEHHKIYVDLIEKPEWYKDFS---PLGKVPALQLTGVKDQPTLVESLIIAEYLDQQY 99
            :|.|.|..:::....|:|:......|:||   |...||.|:    .|...:.||..|..||.::|
  Fly    19 KLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLE----DDGKFIWESHAICAYLVRRY 79

  Fly   100 PQT-RLFPTDPLQKAL-DKIL-----------IERFAPVVSAIYPVLTCNPNAPKDAIPNFENAL 151
            .:: .|:|.|..::|| |:.|           |...|  :...|..:|..|.:..|||  :| |.
  Fly    80 AKSDDLYPKDYFKRALVDQRLHFESGVLFQGCIRNIA--IPLFYKNITEVPRSQIDAI--YE-AY 139

  Fly   152 DVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTKRFEKLLKWRDLM 213
            |..|..:|.:.  |..|..|.|.||.:.........:.       .:|.||:.||..|.|.|
  Fly   140 DFLEAFIGNQA--YLCGPVITIADYSVVSSVSSLVGLA-------AIDAKRYPKLNGWLDRM 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 5..96 CDD:469754 17/60 (28%)
GST_C_Omega 110..235 CDD:198293 31/116 (27%)
GstE9NP_725784.1 GstA 4..199 CDD:440390 53/192 (28%)

Return to query results.
Submit another query.