DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and Clic6

DIOPT Version :10

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_766057.1 Gene:Clic6 / 209195 MGIID:2146607 Length:596 Species:Mus musculus


Alignment Length:126 Identity:30/126 - (23%)
Similarity:52/126 - (41%) Gaps:13/126 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SMAFCPFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPLGKVPALQLTG-VKDQPTLVESLI 90
            |:..||||.|:.::|..|.:..:...|||..||...::.:|....|.:...| ||.....:|..:
Mouse   375 SIGNCPFSQRLFMILWLKGVIFNVTTVDLKRKPADLQNLAPGTNPPFMTFDGEVKTDVNKIEEFL 439

  Fly    91 IAEYLDQQYPQTRLFPTDPLQKALDKILIERFAPVVSAIYPVLTCNPNAPKDAIPNFENAL 151
            ..:.:..:||  :|....|...:....:..:|:..:.          |..|||...:|..|
Mouse   440 EEKLVPPRYP--KLGTQHPESNSAGNDVFAKFSAFIK----------NTKKDANEIYEKNL 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 5..96 CDD:469754 19/69 (28%)
GST_C_Omega 110..235 CDD:198293 7/42 (17%)
Clic6NP_766057.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..360
2A1904 <51..338 CDD:273344
O-ClC 363..596 CDD:129941 30/126 (24%)
G-site. /evidence=ECO:0000250|UniProtKB:Q9Y696 379..382 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.