DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and exl-1

DIOPT Version :10

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_497000.1 Gene:exl-1 / 175100 WormBaseID:WBGene00001371 Length:238 Species:Caenorhabditis elegans


Alignment Length:60 Identity:16/60 - (26%)
Similarity:27/60 - (45%) Gaps:11/60 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 HRVRLMLAAKHIEHHKIYVDLIE---------KPEWYKDFSPLGKVPALQLTGVKDQPTL 85
            |.:|  :|||.:::::|..||..         ..|.::...|..:...|..|.:||.|.|
 Worm   162 HSIR--VAAKMLKNYEIPADLSHVLDYLKAGYATEMFRVSCPSDQEIVLHWTELKDTPRL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 5..96 CDD:469754 16/60 (27%)
GST_C_Omega 110..235 CDD:198293
exl-1NP_497000.1 GST_C_family 98..210 CDD:470672 11/49 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.