DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and Gstt2

DIOPT Version :9

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_011241675.1 Gene:Gstt2 / 14872 MGIID:106188 Length:251 Species:Mus musculus


Alignment Length:228 Identity:47/228 - (20%)
Similarity:90/228 - (39%) Gaps:70/228 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KIYVDLIEKPEWYKDFSPLGKVPALQL----TGVKDQPTLVESLIIAEYLDQQYPQTRLFPTDPL 110
            ::|:||:.:|.           .|:.:    .|:..|...|: ::..:::.:|:.|.        
Mouse     4 ELYLDLLSQPS-----------RAVYIFAKKNGIPFQTRTVD-ILKGQHMSEQFSQV-------- 48

  Fly   111 QKALDKILIERFAPVVSAIYPVLTCNPNA--PKDAI-----PNFENALDVFEVELGKRGTPY-FA 167
             ..|:|:      ||:.....|||.:|::  |..||     ..::.|...:..:|..|...: :.
Mouse    49 -NCLNKV------PVLKDGSFVLTESPSSMIPSTAILIYLSSKYQVADHWYPADLQARAQVHEYL 106

  Fly   168 GQHI----GIVDYMIW-----PWF-ERFPSMKI--NTEQKYELDTKRFEKLLKWR---------- 210
            |.|.    |....::|     |.. .:.|..|:  |.::...:..:..:|.|:.|          
Mouse   107 GWHADNIRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVTL 171

  Fly   211 -DLMTQDEVVQKTALDVQLHAEFQKSKTLGNPQ 242
             |||:.:|::|..||...|   |:     |.||
Mouse   172 ADLMSLEELMQPVALGYNL---FE-----GRPQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 8/49 (16%)
GstA 25..215 CDD:223698 38/199 (19%)
GST_C_Omega 110..235 CDD:198293 34/155 (22%)
Gstt2XP_011241675.1 GST_N_Theta 3..85 CDD:239348 21/107 (20%)
GST_C_Theta 98..223 CDD:198292 24/107 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844522
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.