DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstO2 and tlr12

DIOPT Version :10

Sequence 1:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_002941870.2 Gene:tlr12 / 100498493 XenbaseID:XB-GENE-5824069 Length:936 Species:Xenopus tropicalis


Alignment Length:236 Identity:53/236 - (22%)
Similarity:85/236 - (36%) Gaps:66/236 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FCPFSHRVRLMLAAKHIEHHKIYVDLIEKPEW-YKDFSPL----GKVPALQLTGVKDQPTLVESL 89
            || .:....|:||...|||      :.|...| ..|...|    .::.:||::.:.....|:|..
 Frog   402 FC-MTKLTDLLLARNGIEH------IEESAFWGLNDLRVLDLRNNRLTSLQISSLSGLSNLMELY 459

  Fly    90 IIAEYLD--QQYP---QTRLFPTDPLQKALDKILIERFAPVVSAIYPVLTCNPNAPKDAIPNFEN 149
            :....::  |:|.   ||:|        .|.||   .|..|            :...:..||.| 
 Frog   460 LQNNVMESMQRYSLKWQTKL--------RLVKI---GFVSV------------SVSFELFPNTE- 500

  Fly   150 ALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDTK---RFEKLLKWRD 211
            .||:           ...|::|.:  :|.........|:.:|... .|||.|   :|...|:...
 Frog   501 TLDI-----------QTTGKYITV--FMNETAASSLKSLSVNGSH-VELDIKCGHQFFSTLRELK 551

  Fly   212 LMTQDEVVQKTALDVQL-HAEFQKSKTLGNPQYDIAFKGTP 251
            ::..:.::..:....|| |.|     .|.|.||.  |.|.|
 Frog   552 VINNNGLISCSHYGYQLEHFE-----NLENIQYH--FSGAP 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstO2NP_729388.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 5..96 CDD:469754 16/70 (23%)
GST_C_Omega 110..235 CDD:198293 25/128 (20%)
tlr12XP_002941870.2 leucine-rich repeat 60..82 CDD:275380
leucine-rich repeat 83..105 CDD:275380
leucine-rich repeat 106..128 CDD:275380
leucine-rich repeat 182..207 CDD:275380
leucine-rich repeat 208..233 CDD:275380
LRR 226..633 CDD:443914 53/236 (22%)
leucine-rich repeat 234..279 CDD:275380
leucine-rich repeat 308..331 CDD:275380
leucine-rich repeat 332..355 CDD:275380
leucine-rich repeat 356..382 CDD:275380
leucine-rich repeat 383..406 CDD:275380 2/4 (50%)
leucine-rich repeat 407..430 CDD:275380 8/28 (29%)
leucine-rich repeat 431..454 CDD:275380 3/22 (14%)
leucine-rich repeat 455..478 CDD:275380 5/22 (23%)
TIR 788..930 CDD:214587
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.