DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and CLIC3

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_004660.2 Gene:CLIC3 / 9022 HGNCID:2064 Length:236 Species:Homo sapiens


Alignment Length:181 Identity:41/181 - (22%)
Similarity:74/181 - (40%) Gaps:41/181 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGKVPALEIVREPGPP 82
            |||    .|:..||..||:.:||..|.:|:....::....|:.|.:..|..::|.|....:    
Human    14 EDG----ESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGSQLPILLYDSD---- 70

  Fly    83 VLTESLLICEYLDE-----QYP-LRPLYP-----------------RDPLKKVQDKLLIERFRAV 124
            ..|::|.|.::|:|     .:| |.|.|.                 ::|:....:.|..:..||:
Human    71 AKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRAL 135

  Fly   125 --LGAFFKASDGGDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWP 173
              |.::.:|    .||...:|    |.:|......|..|::..:.|..:.|
Human   136 ARLDSYLRA----PLEHELAG----EPQLRESRRRFLDGDRLTLADCSLLP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 20/76 (26%)
GstA 22..215 CDD:223698 38/177 (21%)
GST_C_Omega 109..229 CDD:198293 14/67 (21%)
CLIC3NP_004660.2 Required for insertion into the membrane. /evidence=ECO:0000250 1..88 22/81 (27%)
PLN02817 5..229 CDD:330276 41/181 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.