DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and CAM1

DIOPT Version :10

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_015277.1 Gene:CAM1 / 856059 SGDID:S000005969 Length:415 Species:Saccharomyces cerevisiae


Alignment Length:120 Identity:23/120 - (19%)
Similarity:36/120 - (30%) Gaps:42/120 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PEWLLEKNPQGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFR 122
            |:...||......||....:|...|..||:        |....:|.:|.:         |:.:..
Yeast   218 PQKKKEKKAPAAAPAASKKKEEAKPAATET--------ETSSKKPKHPLE---------LLGKST 265

  Fly   123 AVLGAFFKASDGGDLEP-----FWSGLDIYERELARRGTEFFGGEQTGILDYMIW 172
            .||..:.:.....|..|     ||               |.:..|     :|.:|
Yeast   266 FVLDDWKRKYSNEDTRPVALPWFW---------------EHYNPE-----EYSLW 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 9/36 (25%)
GST_C_Omega 109..229 CDD:198293 11/69 (16%)
CAM1NP_015277.1 GST_N_EF1Bgamma 4..73 CDD:239342
GST_C_EF1Bgamma_like 92..214 CDD:198290
EF1G 255..359 CDD:459888 12/75 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.