DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU20

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_177958.1 Gene:GSTU20 / 844173 AraportID:AT1G78370 Length:217 Species:Arabidopsis thaliana


Alignment Length:206 Identity:54/206 - (26%)
Similarity:86/206 - (41%) Gaps:34/206 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLICEYLD 95
            |..|..:.|..|.:.:.....:.::|...||:.|| ..|:|.|.   ..|.|| .|||.:.:|:|
plant    15 FGMRARVALREKGVEFEYREEDFSNKSPLLLQSNPIHKKIPVLV---HNGKPV-CESLNVVQYVD 75

  Fly    96 EQYPLR-PLYPRDPLKKVQ--------DKLLIERFRAVLGAFFKASDGGDLEPFWSGLDIYEREL 151
            |.:|.: |.:|.||..:.|        ||...:....|.|...:..:.|..| |...:.|.|.||
plant    76 EAWPEKNPFFPSDPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKE-FIEAVKILESEL 139

  Fly   152 ARRGTEFFGGEQTGILD-----YMIWPWCERLELLKLQRGEDY-NYD-QSRFPQLTLWLERMKRD 209
            ..:  .:|||:..|.:|     :..|          .|..|.: |:. :|..|:|..|.:|....
plant   140 GDK--PYFGGDSFGYVDISLITFSSW----------FQAYEKFGNFSIESESPKLIAWAKRCMEK 192

  Fly   210 PAVMAFYMEAE 220
            .:|.....::|
plant   193 ESVSKSLPDSE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 19/63 (30%)
GstA 22..215 CDD:223698 53/199 (27%)
GST_C_Omega 109..229 CDD:198293 28/127 (22%)
GSTU20NP_177958.1 GST_N_Tau 6..78 CDD:239356 21/66 (32%)
GST_C_Tau 89..209 CDD:198294 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.