DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU21

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001319402.1 Gene:GSTU21 / 844172 AraportID:AT1G78360 Length:220 Species:Arabidopsis thaliana


Alignment Length:225 Identity:58/225 - (25%)
Similarity:94/225 - (41%) Gaps:40/225 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FCP--FAQRVHLVLDAKQIPYHSIYIN---LTDKPEWLLEKNPQGKVPALEIVREPGPPVLTESL 88
            |.|  |..|..:.|:.|.:.|.  |..   :.:|...|||.||..|  .:.::...|.||| |||
plant    10 FWPSMFGMRTMIALEEKGVKYE--YREEDVINNKSPLLLEMNPIHK--TIPVLIHNGKPVL-ESL 69

  Fly    89 LICEYLDEQY-PLRPLYPRDPLKKVQ--------DKLLIERFRAVLGAFFKASDGGDLE----PF 140
            :..:|:||.: ......|.||..:.|        ||.|.     |.|....|:.|.:||    .|
plant    70 IQIQYIDEVWSDNNSFLPSDPYHRAQALFWADFIDKKLY-----VCGRKTWATKGEELEAANKEF 129

  Fly   141 WSGLDIYERELARRGTEFFGGEQTGILDYMI---WPWCERLELLKLQRGEDYNYDQSRFPQLTLW 202
            ...|...:.||..:  .:|||::.|.:|.::   :.|     ....|:..:::.:.... :|..|
plant   130 IEILKTLQCELGEK--PYFGGDKFGFVDIVLIGFYSW-----FPAYQKFGNFSIEPECL-KLIAW 186

  Fly   203 LER-MKRDPAVMAFYMEAEVQAEFLRTRSL 231
            .:| |:|:....|.....:|....|:.:.|
plant   187 GKRCMQRESVAKALPDSEKVVGYVLQLKKL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 23/70 (33%)
GstA 22..215 CDD:223698 54/207 (26%)
GST_C_Omega 109..229 CDD:198293 29/135 (21%)
GSTU21NP_001319402.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.