DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU22

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_177956.1 Gene:GSTU22 / 844169 AraportID:AT1G78340 Length:218 Species:Arabidopsis thaliana


Alignment Length:218 Identity:55/218 - (25%)
Similarity:95/218 - (43%) Gaps:33/218 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLICEYL 94
            ||..|..:.|..|.:.:.....||.||...||:.|| ..|:|   ::...|.|| .||:.:.:|:
plant    14 PFGVRARIALREKGVEFEYREENLRDKSPLLLQMNPVHKKIP---VLIHNGKPV-CESMNVVQYI 74

  Fly    95 DEQY-PLRPLYPRDPLKKVQDKLLIERFRAVLGAFFKASD------GGDLE----PFWSGLDIYE 148
            ||.: ...|:.|.||.::.|.:..::.....|   |:.:|      |.:.|    .:...|.|.|
plant    75 DEVWSDKNPILPSDPYQRAQARFWVDFVDTKL---FEPADKIWQTKGEEQETAKKEYIEALKILE 136

  Fly   149 RELARRGTEFFGGEQTGILDYMI---WPWCERLELLKLQRGEDYNYD-QSRFPQLTLWLER-MKR 208
            .||..:  .:|||:..|.:|..:   :.|.|..|.|.       |:. :...|.|....:| ::|
plant   137 TELGDK--PYFGGDTFGFVDIAMTGYYSWFEASEKLA-------NFSIEPECPTLMASAKRCLQR 192

  Fly   209 DPAVMAFYMEAEVQAEFLRTRSL 231
            :..|.:.:...::.|...:.|.:
plant   193 ESVVQSLHDSEKILAFAYKIRKI 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 21/64 (33%)
GstA 22..215 CDD:223698 53/200 (27%)
GST_C_Omega 109..229 CDD:198293 27/134 (20%)
GSTU22NP_177956.1 GST_N_Tau 5..78 CDD:239356 23/67 (34%)
GST_C_Tau 89..212 CDD:198294 28/134 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.