DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU23

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_177955.1 Gene:GSTU23 / 844167 AraportID:AT1G78320 Length:220 Species:Arabidopsis thaliana


Alignment Length:198 Identity:52/198 - (26%)
Similarity:88/198 - (44%) Gaps:29/198 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLICEYLD 95
            :..|..:.|:.|::.|.....:|::|...||:.|| ..|:|.|  :.| |.|: .||::..:|:|
plant    15 YGMRTRIALEEKKVKYEYREEDLSNKSPLLLQMNPIHKKIPVL--IHE-GKPI-CESIIQVQYID 75

  Fly    96 EQYP-LRPLYPRDPLKKVQ--------DKLLIERFRAVLGAFFKASDGGDLEPFWSGLDIYEREL 151
            |.:| ..|:.|.||.::.|        ||......:|:.....:..:...:| |...|...:.||
plant    76 ELWPDTNPILPSDPYQRAQARFWADYIDKKTYVPCKALWSESGEKQEAAKIE-FIEVLKTLDSEL 139

  Fly   152 ARRGTEFFGGEQTGILDYM---IWPWCERLELLKLQRGEDYNYD-QSRFPQLTLWLER-MKRDPA 211
            ..:  .:|||.:.|::|..   .:.|....|       |..|.. ...||:|..|.:| :||:..
plant   140 GDK--YYFGGNEFGLVDIAFIGFYSWFRTYE-------EVANLSIVLEFPKLMAWAQRCLKRESV 195

  Fly   212 VMA 214
            ..|
plant   196 AKA 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 19/63 (30%)
GstA 22..215 CDD:223698 52/198 (26%)
GST_C_Omega 109..229 CDD:198293 26/119 (22%)
GSTU23NP_177955.1 GST_N_Tau 5..78 CDD:239356 21/66 (32%)
GST_C_Tau 89..211 CDD:198294 27/120 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.