DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and DHAR2

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_177662.1 Gene:DHAR2 / 843864 AraportID:AT1G75270 Length:213 Species:Arabidopsis thaliana


Alignment Length:226 Identity:64/226 - (28%)
Similarity:103/226 - (45%) Gaps:42/226 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGKVPALEIVRE 78
            |||..|          |||:|||.|.|:.|::||.:..||::|||:|.|:.:|:||||   :|:.
plant    14 PDVLGD----------CPFSQRVLLTLEEKKLPYKTHLINVSDKPQWFLDISPEGKVP---VVKL 65

  Fly    79 PGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAVLGAFF------KASDGGDL 137
            .|..| .:|.:|...|:|:||...|........|..|        :.|||.      .|:||.: 
plant    66 DGKWV-ADSDVIVGLLEEKYPEPSLKTPPEFASVGSK--------IFGAFVTFLKSKDANDGSE- 120

  Fly   138 EPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDY----------NYD 192
            :.....|:..|..|......|..||:...:|..:.|....|| :.|...:::          ||.
plant   121 KALVDELEALENHLKTHSGPFVAGEKITAVDLSLAPKLYHLE-VALGHYKNWSVPESLTSVRNYA 184

  Fly   193 QSRFPQLTLWLERMKRDPAVMAFYMEAEVQA 223
            ::.|.:.:....:.|::..|..:  |::|.|
plant   185 KALFSRESFENTKAKKEIVVAGW--ESKVNA 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 32/80 (40%)
GstA 22..215 CDD:223698 57/208 (27%)
GST_C_Omega 109..229 CDD:198293 27/131 (21%)
DHAR2NP_177662.1 PLN02378 1..212 CDD:166019 62/223 (28%)
GST_N_3 19..88 CDD:290153 33/82 (40%)
GST_C_DHAR 89..210 CDD:198310 26/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.