DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU10

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_177598.1 Gene:GSTU10 / 843799 AraportID:AT1G74590 Length:232 Species:Arabidopsis thaliana


Alignment Length:204 Identity:49/204 - (24%)
Similarity:82/204 - (40%) Gaps:52/204 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLICEYLD 95
            :::||.:.|..|.:.|..:..:|.:|.|.|::.|| ..|:|.|.   ..|.|| .|||:|.||:|
plant    18 YSKRVEIALKLKGVLYEYLEEDLQNKSESLIQLNPVHKKIPVLV---HDGKPV-AESLVILEYID 78

  Fly    96 EQYPLRP-LYPRDPLKKVQDKLLI----ERFRAVLGAF------------------FKASDGGDL 137
            |.:...| .:|.||.::.|.:..:    ::...|:|..                  ||..|.| |
plant    79 ETWTNSPRFFPEDPYERAQVRFWVSYINQQVFEVMGQVMSQEGEAQAKSVEEARKRFKVLDEG-L 142

  Fly   138 EPFWSGLDI-------------------YERELARRGTEFFGGEQTGILDYMIWPWCERLELLKL 183
            :..:...:|                   |:......|.:..|...|..|    :.|.|||:.|.:
plant   143 KKHFPNKNIRRNDDVGLLEITIIATLGGYKAHREAIGVDIIGPVNTPTL----YNWIERLQDLSV 203

  Fly   184 QRGEDYNYD 192
            .:..:..:|
plant   204 IKEVEVPHD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 23/63 (37%)
GstA 22..215 CDD:223698 49/204 (24%)
GST_C_Omega 109..229 CDD:198293 20/125 (16%)
GSTU10NP_177598.1 GST_N_Tau 8..81 CDD:239356 25/66 (38%)
GST_C_Tau 92..221 CDD:198294 21/126 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.