DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU11

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_177151.1 Gene:GSTU11 / 843329 AraportID:AT1G69930 Length:234 Species:Arabidopsis thaliana


Alignment Length:218 Identity:59/218 - (27%)
Similarity:93/218 - (42%) Gaps:31/218 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGK-VPALEIVREPGPPVLTESLLICEYL 94
            ||..|..:.|:.|.:.|..:....|...|.:|..||..| :|.|....:|    :.|||.|..|:
plant    22 PFVLRTRIALNLKNVAYEYLEEEDTLSSESVLNYNPVHKQIPILIHGNKP----IRESLNIVMYV 82

  Fly    95 DEQY---PLRPLYPRDP----LKKVQDKLLIER-FRAVLG-AFFKASDG-----GDLEPFWSGLD 145
            ||.:   |  |:.|.||    :.:..|..:.|. |.::.| |..|..:.     ..||...:.|:
plant    83 DETWLSGP--PILPSDPFDRAVARFWDVYIDEHCFTSINGVAVAKGEENINAAIAKLEQCMALLE 145

  Fly   146 IYERELARRGTEFFGGEQTGILDY----MIWPWCERLELLKLQRGEDYNYDQSRFPQLTLWLERM 206
            ...:|.: :|..|||||..|.:|.    |:.|    |.:|:...|..:.:.::. |.|..|.:|.
plant   146 ETFQECS-KGRGFFGGENIGFIDIGFGSMLGP----LTVLEKFTGVKFIHPENT-PGLFHWADRF 204

  Fly   207 KRDPAVMAFYMEAEVQAEFLRTR 229
            ....||.....:.|...:|.|.:
plant   205 YAHEAVKPVMPDIEKLVQFARLK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 20/64 (31%)
GstA 22..215 CDD:223698 56/202 (28%)
GST_C_Omega 109..229 CDD:198293 32/130 (25%)
GSTU11NP_177151.1 GST_N_Tau 13..86 CDD:239356 22/67 (33%)
GST_C_Tau 97..225 CDD:198294 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.