DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU12

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_177150.2 Gene:GSTU12 / 843328 AraportID:AT1G69920 Length:254 Species:Arabidopsis thaliana


Alignment Length:233 Identity:58/233 - (24%)
Similarity:86/233 - (36%) Gaps:68/233 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFAQRVHLVLDAKQIPYHSIYINLTD----KPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLI 90
            |||.|..:.|..|.:.:.  |:..||    |.:.|::.|| ..|||.|    ..|...:.|||.|
plant    44 PFAIRAQVALHLKSVEHE--YVEETDVLKGKSDLLIKSNPIHKKVPVL----IHGDVSICESLNI 102

  Fly    91 CEYLDEQYP----LRPLYPR--------------------DPLKKVQDKL--------LIERFRA 123
            .:|:||.:|    :.|..|.                    |.:...:|..        |:|...|
plant   103 VQYVDESWPSDLSILPTLPSERAFARFWAHFVDGKLFESIDAVAGAKDDAARMTLAGNLMENLAA 167

  Fly   124 VLGAFFKASDGGDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGED 188
            :..||.|:|.|||                     ||||...|.:|..:......:.:::...|..
plant   168 LEEAFQKSSKGGD---------------------FFGGGNIGFVDITVGAIVGPISVIEAFSGVK 211

  Fly   189 YNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFL 226
            :....:. |.|..|.|:.:...||.. ||  ...|||:
plant   212 FLRPDTT-PGLIQWAEKFRAHEAVKP-YM--PTVAEFI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 23/68 (34%)
GstA 22..215 CDD:223698 53/220 (24%)
GST_C_Omega 109..229 CDD:198293 29/126 (23%)
GSTU12NP_177150.2 GST_N_Tau 35..110 CDD:239356 25/71 (35%)
GstA 36..243 CDD:223698 55/229 (24%)
GST_C_Tau 121..250 CDD:198294 31/150 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.