DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU28

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_175772.1 Gene:GSTU28 / 841805 AraportID:AT1G53680 Length:224 Species:Arabidopsis thaliana


Alignment Length:216 Identity:56/216 - (25%)
Similarity:92/216 - (42%) Gaps:27/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLICEYL 94
            |:|.|..:.|..|.:.:.....:|.:|.|.||:.|| ..|||.|.....|    ::|||:..:|:
plant    17 PYAMRTKVALREKGVEFEVQEEDLWNKSELLLKSNPVHKKVPVLIHNNTP----ISESLIQVQYI 77

  Fly    95 DEQY-PLRPLYPRDPLKKV--------QDKLL-IERFRAVLGAFFKASDGGDLEPFWSGLDIYER 149
            ||.: ......|.||..:.        .||.: .|..|.:.|...........:.|...|.:.|.
plant    78 DETWTDAASFLPSDPQSRATARFWADYADKTISFEGGRKIWGNKKGEEQEKGKKEFLESLKVLEA 142

  Fly   150 ELARRGTEFFGGEQTGILDYMIWP---WCERLELLKLQRGEDYNYDQSRFPQLTLWLERMKRDPA 211
            ||..:  .:||||..|.:|..:.|   |     ...|::..|::. ::..|::..|.:|.....:
plant   143 ELGDK--SYFGGETFGYVDITLVPFYSW-----FYALEKCGDFSV-EAECPKIVAWGKRCVERNS 199

  Fly   212 VMAFYMEAE-VQAEFLRTRSL 231
            |.|...|:| |..:.|:.|.:
plant   200 VAATLPESEKVYQQVLKLRQI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 21/64 (33%)
GstA 22..215 CDD:223698 50/197 (25%)
GST_C_Omega 109..229 CDD:198293 29/132 (22%)
GSTU28NP_175772.1 GST_N_Tau 8..81 CDD:239356 23/67 (34%)
GST_C_Tau 92..217 CDD:198294 30/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.