DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU14

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_174034.1 Gene:GSTU14 / 839603 AraportID:AT1G27140 Length:243 Species:Arabidopsis thaliana


Alignment Length:223 Identity:58/223 - (26%)
Similarity:90/223 - (40%) Gaps:38/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFAQRVHLVLDAKQIPYHSIYI-----NLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLL 89
            ||:.|..:.|..|.|.|.  |:     :|.:|.:.||:.|| ..|.|.|    ..|...:.|||.
plant    16 PFSIRPRVALHLKSIKYE--YLEEPDDDLGEKSQLLLKSNPIHKKTPVL----IHGDLAICESLN 74

  Fly    90 ICEYLDEQYPLRP-LYPRDPLKK---------VQDKLLIERFRAVLGAFFKASDGGDLE------ 138
            |.:||||.:|..| :.|.:...:         :.|| ..|...|:.||      ..|.|      
plant    75 IVQYLDEAWPSDPSILPSNAYDRASARFWAQYIDDK-CFEAANALTGA------NNDEERIAATG 132

  Fly   139 PFWSGLDIYER--ELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRFPQLTL 201
            .....|.|.|.  :.:.:|..|||||..|.||.........:.::::...:.:..:::. |.|..
plant   133 KLTECLAILEETFQKSSKGLGFFGGETIGYLDIACAALLGPISVIEMFSADKFVREETT-PGLIQ 196

  Fly   202 WLERMKRDPAVMAFYMEAEVQAEFLRTR 229
            |..|.:...||..:....|...|.::.|
plant   197 WAVRFRAHEAVRPYMPTVEEVTELVKQR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 23/69 (33%)
GstA 22..215 CDD:223698 55/207 (27%)
GST_C_Omega 109..229 CDD:198293 28/136 (21%)
GSTU14NP_174034.1 GST_N_Tau 7..83 CDD:239356 26/72 (36%)
GST_C_Tau 94..224 CDD:198294 28/137 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.