DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU25

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_173161.1 Gene:GSTU25 / 838289 AraportID:AT1G17180 Length:221 Species:Arabidopsis thaliana


Alignment Length:213 Identity:60/213 - (28%)
Similarity:96/213 - (45%) Gaps:28/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FCP--FAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLI 90
            |.|  |..|..:.|:.|.:.:.....:|.:|...|||.|| ..|:|   ::...|.|| .|||:.
plant    10 FWPSMFGMRTRIALEEKNVKFDYREQDLWNKSPILLEMNPVHKKIP---VLIHNGNPV-CESLIQ 70

  Fly    91 CEYLDEQYPLR-PLYPRDPLKKVQ--------DKLLIERFRAVLGAFFKASDGGDLEPFWSGLDI 146
            .||:||.:|.: ||.|.||.::.|        ||.:....|.:.||..:..:.|..| |...|..
plant    71 IEYIDEVWPSKTPLLPSDPYQRAQAKFWGDFIDKKVYASARLIWGAKGEEHEAGKKE-FIEILKT 134

  Fly   147 YERELARRGTEFFGGEQTGILDYMI---WPWCERLELLKLQRGEDYNYDQSRFPQLTLWLERMKR 208
            .|.||..:  .:||||..|.:|..:   :.|.|..|     :...::. ::..|:|..|.:|...
plant   135 LESELGDK--TYFGGETFGYVDIALIGFYSWFEAYE-----KFGSFSI-EAECPKLIAWGKRCVE 191

  Fly   209 DPAVMAFYMEAEVQAEFL 226
            ..:|.....::|...:|:
plant   192 RESVAKSLPDSEKIIKFV 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 23/68 (34%)
GstA 22..215 CDD:223698 58/200 (29%)
GST_C_Omega 109..229 CDD:198293 29/129 (22%)
GSTU25NP_173161.1 GST_N_Tau 5..78 CDD:239356 25/71 (35%)
GST_C_Tau 89..209 CDD:198294 29/128 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.