DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU24

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_173160.1 Gene:GSTU24 / 838288 AraportID:AT1G17170 Length:218 Species:Arabidopsis thaliana


Alignment Length:217 Identity:59/217 - (27%)
Similarity:91/217 - (41%) Gaps:31/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLICEYLD 95
            |..|..:.|..|::.|.....:|.:|...|||.|| ..|:|   ::...|.|| .|||:..||:|
plant    15 FGMRTRIALAEKRVKYDHREEDLWNKSSLLLEMNPVHKKIP---VLIHNGKPV-CESLIQIEYID 75

  Fly    96 EQYP-LRPLYPRDPLKKVQDKL---LIERFRAVLGAFFKASDGGDLEPFWSGLDI---YERELAR 153
            |.:| ..||.|.||.|:...|.   .|::...|......|..|.:.|.....::|   .|.||..
plant    76 ETWPDNNPLLPSDPYKRAHAKFWADFIDKKVNVTARRIWAVKGEEQEAAKELIEILKTLESELGD 140

  Fly   154 RGTEFFGGEQTGILDYMI---WPW---CERLELLKLQRGEDYNYDQSRFPQLTLWLERMKRDPAV 212
            :  ::||.|..|.:|..:   ..|   .|:...:.:         :|...:|..|.:|.....:|
plant   141 K--KYFGDETFGYVDIALIGFHSWFAVYEKFGNVSI---------ESECSKLVAWAKRCLERESV 194

  Fly   213 MAFYMEAEVQAEFL--RTRSLG 232
            .....|:|....|:  |.:.||
plant   195 AKALPESEKVITFISERRKKLG 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 22/63 (35%)
GstA 22..215 CDD:223698 53/196 (27%)
GST_C_Omega 109..229 CDD:198293 27/133 (20%)
GSTU24NP_173160.1 GST_N_Tau 5..78 CDD:239356 24/66 (36%)
GstA 6..197 CDD:223698 53/196 (27%)
GST_C_Tau 89..211 CDD:198294 27/132 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.