DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and ERD9

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_172508.4 Gene:ERD9 / 837576 AraportID:AT1G10370 Length:227 Species:Arabidopsis thaliana


Alignment Length:213 Identity:59/213 - (27%)
Similarity:91/213 - (42%) Gaps:24/213 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLICEYL 94
            ||..|..:.|:.|.:||..:......|.|.||:.|| ..|:|.|....:|    ::||.:|.||:
plant    15 PFVMRPRIALNLKSVPYEFLQETFGSKSELLLKSNPVHKKIPVLLHADKP----VSESNIIVEYI 75

  Fly    95 DEQYPLR--PLYPRDPLKKVQDKL----LIERFRAVLGAFFKASDGGDLE------PFWSGLDIY 147
            |:.:...  .:.|.||..:...:.    :.|::...|..|.||  ||:.|      ....|....
plant    76 DDTWSSSGPSILPSDPYDRAMARFWAAYIDEKWFVALRGFLKA--GGEEEKKAVIAQLEEGNAFL 138

  Fly   148 EREL--ARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYN-YDQSRFPQLTLWLERMKRD 209
            |:..  ..:|..||.|:..|.||..:..:...|.:.:|  ...|. .|:::.|.|:.|.|....|
plant   139 EKAFIDCSKGKPFFNGDNIGYLDIALGCFLAWLRVTEL--AVSYKILDEAKTPSLSKWAENFCND 201

  Fly   210 PAVMAFYMEAEVQAEFLR 227
            |||.....|....|||.:
plant   202 PAVKPVMPETAKLAEFAK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 22/64 (34%)
GstA 22..215 CDD:223698 55/199 (28%)
GST_C_Omega 109..229 CDD:198293 33/132 (25%)
ERD9NP_172508.4 GST_N_Tau 6..79 CDD:239356 23/67 (34%)
GST_C_Tau 91..221 CDD:198294 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.