DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU18

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_172507.1 Gene:GSTU18 / 837575 AraportID:AT1G10360 Length:227 Species:Arabidopsis thaliana


Alignment Length:222 Identity:63/222 - (28%)
Similarity:89/222 - (40%) Gaps:44/222 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 FAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLICEYLD 95
            :..|..:.|..|.|.|..:......|.|.||:.|| ..|:|.|....:|    :.||.:|..|:|
plant    16 YVMRARIALHLKSISYEFLQETYGSKSELLLKSNPVHKKMPVLIHADKP----VCESNIIVHYID 76

  Fly    96 EQY-----PLRPLYPRDP------LKKVQDKLLIERFRAVLGAFFKASDGGDLEPFWSGLDIYER 149
            |.:     .:.|.:|.|.      ...:.|:..|. .|::|.|      .||.|...:...:.||
plant    77 EAWNSSGPSILPSHPYDRAIARFWAAYIDDQWFIS-VRSILTA------QGDEEKKAAIAQVEER 134

  Fly   150 ----ELA----RRGTEFFGGEQTGILDYMIWP---WCERLELLKLQRGEDYNY---DQSRFPQLT 200
                |.|    .:|..||.|:..|.||..:..   |...:||       |.|:   |:::.|.|.
plant   135 TKLLEKAFNDCSQGKPFFNGDHIGYLDIALGSFLGWWRVVEL-------DANHKFLDETKTPSLV 192

  Fly   201 LWLERMKRDPAVMAFYMEAEVQAEFLR 227
            .|.||...||||.....|....|||.|
plant   193 KWAERFCDDPAVKPIMPEITKLAEFAR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 19/63 (30%)
GstA 22..215 CDD:223698 58/208 (28%)
GST_C_Omega 109..229 CDD:198293 39/133 (29%)
GSTU18NP_172507.1 GST_N_Tau 6..79 CDD:239356 21/66 (32%)
GST_C_Tau 91..221 CDD:198294 41/143 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.