DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU9

DIOPT Version :10

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_851249.1 Gene:GSTU9 / 836368 AraportID:AT5G62480 Length:240 Species:Arabidopsis thaliana


Alignment Length:83 Identity:31/83 - (37%)
Similarity:47/83 - (56%) Gaps:6/83 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLICEYL 94
            |:::|:.|.|..|.|||..:..:|.:|.:.||..|| ..|:|.|.   ..|.|: :|||.|.||:
plant    18 PYSKRIELALRLKSIPYQFVQEDLQNKSQTLLRYNPVHKKIPVLV---HNGKPI-SESLFIIEYI 78

  Fly    95 DEQYPLRP-LYPRDPLKK 111
            ||.:...| :.|.||.::
plant    79 DETWSNGPHILPEDPYRR 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 25/64 (39%)
GST_C_Omega 109..229 CDD:198293 0/3 (0%)
GSTU9NP_851249.1 GST_N_Tau 9..82 CDD:239356 27/67 (40%)
GST_C_Tau 93..226 CDD:198294 1/4 (25%)

Return to query results.
Submit another query.