DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTL1

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001318461.1 Gene:GSTL1 / 831800 AraportID:AT5G02780 Length:237 Species:Arabidopsis thaliana


Alignment Length:218 Identity:68/218 - (31%)
Similarity:101/218 - (46%) Gaps:26/218 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DGILRLYSMRFCPFAQRVHLVLDAK--QIPYHSIYINLTDKPEWLLEK-NPQGKVPALEIVREPG 80
            ||..|||....|||||||.:..:.|  |.....:.|:|.::|.||.|| ||..|||||    |..
plant    28 DGTTRLYISYTCPFAQRVWITRNLKGLQDEIKLVPIDLPNRPAWLKEKVNPANKVPAL----EHN 88

  Fly    81 PPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLI----ERF-RAVLGAFFKASDGGDLEPF 140
            ..:..|||.:.:|:|..:....|||.|..|:...:.|:    |.| :.|.|:|    .|..::..
plant    89 GKITGESLDLIKYVDSNFDGPSLYPEDSAKREFGEELLKYVDETFVKTVFGSF----KGDPVKET 149

  Fly   141 WSGLDIYERELAR--RGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRFPQLTLWL 203
            .|..|..|..|.:  .|..|.|  :..::|....|:.||.::. |.....|.....| |.|..|:
plant   150 ASAFDHVENALKKFDDGPFFLG--ELSLVDIAYIPFIERFQVF-LDEVFKYEIIIGR-PNLAAWI 210

  Fly   204 ERMKRDPAVMAFYMEAEVQAEFL 226
            |:|.:    |..|.:.:..:|::
plant   211 EQMNK----MVAYTQTKTDSEYV 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 33/78 (42%)
GstA 22..215 CDD:223698 64/202 (32%)
GST_C_Omega 109..229 CDD:198293 30/125 (24%)
GSTL1NP_001318461.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.