DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTL3

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_195899.1 Gene:GSTL3 / 831798 AraportID:AT5G02790 Length:235 Species:Arabidopsis thaliana


Alignment Length:228 Identity:70/228 - (30%)
Similarity:99/228 - (43%) Gaps:45/228 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PMP-----DVPE--DGILRLYSMRFCPFAQRVHLVLDAK--QIPYHSIYINLTDKPEWLLEK-NP 66
            |.|     |.|.  ||..|||:...|||||||.:..:.|  |.....:.::|.::|.|..|| .|
plant    12 PAPLDATSDPPSLFDGTTRLYTSYVCPFAQRVWITRNFKGLQEKIKLVPLDLGNRPAWYKEKVYP 76

  Fly    67 QGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKK-VQDKLL--IERFRAVLGAF 128
            :.|||||    |....::.|||.:.:|||..:....|||.|..|: ..|:||  .:.|...:...
plant    77 ENKVPAL----EHNGKIIGESLDLIKYLDNTFEGPSLYPEDHAKREFGDELLKYTDTFVKTMYVS 137

  Fly   129 FKASDGGDLEPFWSGLDIYERELAR--RGTEFFGGEQTGILDYMIWPWCERL-----ELLKLQRG 186
            .|.....:..|.   ||..|..|.:  .|..|.|  |..::|....|:.||.     ||.|.   
plant   138 LKGDPSKETAPV---LDYLENALYKFDDGPFFLG--QLSLVDIAYIPFIERFQTVLNELFKC--- 194

  Fly   187 EDYNYDQSRFPQLTLWLERM---------KRDP 210
             |...::   |:|:.|:|.:         |.||
plant   195 -DITAER---PKLSAWIEEINKSDGYAQTKMDP 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 34/92 (37%)
GstA 22..215 CDD:223698 64/211 (30%)
GST_C_Omega 109..229 CDD:198293 30/121 (25%)
GSTL3NP_195899.1 GstA 31..210 CDD:223698 60/194 (31%)
GST_N_3 31..108 CDD:290153 29/80 (36%)
GST_C_Lambda 113..231 CDD:198312 31/123 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.