DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and DHAR3

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_568336.1 Gene:DHAR3 / 831532 AraportID:AT5G16710 Length:258 Species:Arabidopsis thaliana


Alignment Length:226 Identity:59/226 - (26%)
Similarity:89/226 - (39%) Gaps:73/226 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGKVPALEIVRE--PGPPVLTESLLICE 92
            |||.|:|.|.::.|.:||....::|::||||.|:.:|:||||.::...:  |...|:|::     
plant    66 CPFCQKVLLTMEEKNVPYDMKMVDLSNKPEWFLKISPEGKVPVVKFDEKWVPDSDVITQA----- 125

  Fly    93 YLDEQYPLRPLYPRDPLKKVQDKLLIERFRAVLGAFFKASDGGDLEPFWSGLDIYERELARRGTE 157
             |:|:||..||........|..|:    |...:| |.|:.|.||                  |||
plant   126 -LEEKYPEPPLATPPEKASVGSKI----FSTFVG-FLKSKDSGD------------------GTE 166

  Fly   158 -------------------FFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQSRFPQLTLWL 203
                               |..||:....|..:.|   :|..:|:..|...|:..          
plant   167 QVLLDELTTFNDYIKDNGPFINGEKISAADLSLAP---KLYHMKIALGHYKNWSV---------- 218

  Fly   204 ERMKRDPAVMAF---YMEAEVQAE-FLRTRS 230
                  |..:.|   |||.....| |..||:
plant   219 ------PDSLPFVKSYMENVFSRESFTNTRA 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 23/66 (35%)
GstA 22..215 CDD:223698 51/205 (25%)
GST_C_Omega 109..229 CDD:198293 28/142 (20%)
DHAR3NP_568336.1 PLN02817 3..258 CDD:166458 59/226 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3083
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.