DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTL2

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_191064.1 Gene:GSTL2 / 824670 AraportID:AT3G55040 Length:292 Species:Arabidopsis thaliana


Alignment Length:241 Identity:75/241 - (31%)
Similarity:104/241 - (43%) Gaps:47/241 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VPE-----------DGILRLYSMRFCPFAQRVHLVLDAK--QIPYHSIYINLTDKPEWLLEK-NP 66
            |||           ||..|||....||||||..:..:.|  |.....:.|:|.::|.|..|| ..
plant    64 VPELDSSSEPVQVFDGSTRLYISYTCPFAQRAWIARNYKGLQNKIELVPIDLKNRPAWYKEKVYS 128

  Fly    67 QGKVPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKK--VQDKLLIERFRAVLGAFF 129
            ..|||||    |....||.|||.:.:|:|..:....|.| |.|:|  |.|:||     :...:|.
plant   129 ANKVPAL----EHNNRVLGESLDLIKYIDTNFEGPSLTP-DGLEKQVVADELL-----SYTDSFS 183

  Fly   130 KA----SDGGDLEPFWSGLDIYERELAR--RGTEFFGGEQTGILDYMIWPWCERLELLKLQRGED 188
            ||    .:|.|........|..|:.|::  .|..|.|  |..::|....|:.||..|:   ..:.
plant   184 KAVRSTLNGTDTNAADVAFDYIEQALSKFNEGPFFLG--QFSLVDVAYAPFIERFRLI---LSDV 243

  Fly   189 YNYD-QSRFPQLTLWLERM---------KRDPAVMAFYMEAEVQAE 224
            .|.| .|..|.|.||::.|         ::||..:....:..||||
plant   244 MNVDITSGRPNLALWIQEMNKIEAYTETRQDPQELVERYKRRVQAE 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 34/92 (37%)
GstA 22..215 CDD:223698 66/213 (31%)
GST_C_Omega 109..229 CDD:198293 37/134 (28%)
GSTL2NP_191064.1 GstA 83..267 CDD:223698 63/198 (32%)
GST_N_3 83..160 CDD:290153 29/80 (36%)
GST_C_Lambda 167..283 CDD:198312 32/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2726
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.