DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU27

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_189966.1 Gene:GSTU27 / 823491 AraportID:AT3G43800 Length:227 Species:Arabidopsis thaliana


Alignment Length:208 Identity:58/208 - (27%)
Similarity:91/208 - (43%) Gaps:38/208 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MRFCP--FAQRVHLVLDAKQIPY----HSIYINLTDKPEWLLEKNPQGKVPALEIVREPGPPVLT 85
            :.|.|  |..||.:.|:.|:|.:    ..::...||   .||:.||..|  .:.::...|.|| .
plant     9 LNFWPSMFGARVIMALEEKEIKFEYKEEDVFGQKTD---LLLQSNPVNK--KIPVLIHNGKPV-C 67

  Fly    86 ESLLICEYLDEQY----PLRPLYPRDPLKKVQ--------DKLLIERFRAVLGAFFKASDGGDLE 138
            ||.:|.||:||.:    .|| |.|.||.:|.|        ||.:.:..|.......|..:....|
plant    68 ESNIIVEYIDEVWKDDKTLR-LLPSDPYQKSQCRFWADLIDKKVFDAGRRTWTKRGKEQEEAKQE 131

  Fly   139 PFWSGLDIYERELARRGTEFFGG-EQTGILDYMI---WPWCERLELLKLQRGEDYNYDQSRFPQL 199
             |...|.:.||||..:  .:||| :...::|.::   :||....|.:.....||:.      |:|
plant   132 -FIEILKVLERELGDK--VYFGGNDNVSMVDLVLISYYPWFHTWETIGGFSVEDHT------PKL 187

  Fly   200 TLWLERMKRDPAV 212
            ..|:.:....||:
plant   188 MDWIRKCLTRPAI 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 23/73 (32%)
GstA 22..215 CDD:223698 58/208 (28%)
GST_C_Omega 109..229 CDD:198293 27/116 (23%)
GSTU27NP_189966.1 GST_N_Tau 6..80 CDD:239356 25/76 (33%)
GST_C_Tau 93..217 CDD:198294 28/117 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.770

Return to query results.
Submit another query.