DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU1

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_180510.1 Gene:GSTU1 / 817498 AraportID:AT2G29490 Length:224 Species:Arabidopsis thaliana


Alignment Length:210 Identity:65/210 - (30%)
Similarity:104/210 - (49%) Gaps:30/210 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLTESLLICEYL 94
            ||::||.:.|..|.:||..:..:|.:|...|||.|| ..|||.|    .....:|.||.||.||:
plant    17 PFSRRVEMALKLKGVPYEYLEEDLPNKTPLLLELNPLHKKVPVL----VHNDKILLESHLILEYI 77

  Fly    95 DEQYPLRPLYPRDPLKK---------VQDKLLIERFRAVLGAFFKASDGGD--LEPFWSGLDIYE 148
            |:.:...|:.|:||.:|         :.|::|...||:::    ||..|.:  :|.....|...|
plant    78 DQTWKNSPILPQDPYEKAMARFWAKFIDDQILTLGFRSLV----KAEKGREVAIEETRELLMFLE 138

  Fly   149 RELARRGTEFFGGEQTGILDYM---IWPWCERLELLKLQRGEDYN-YDQSRFPQLTLWLERMKRD 209
            :|:.  |.:||||:..|.||.:   :.|:|    |.:|.:|...: ..:.:||:|..|::.::..
plant   139 KEVT--GKDFFGGKTIGFLDMIAGSMIPFC----LARLWKGIGIDMIPEEKFPELNRWIKNLEEV 197

  Fly   210 PAVMAFYMEAEVQAE 224
            .||.......|.|.|
plant   198 EAVRGCIPPREKQIE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 26/64 (41%)
GstA 22..215 CDD:223698 62/199 (31%)
GST_C_Omega 109..229 CDD:198293 34/131 (26%)
GSTU1NP_180510.1 GST_N_Tau 8..81 CDD:239356 27/67 (40%)
GstA 9..201 CDD:223698 61/197 (31%)
GST_C_Tau 91..217 CDD:198294 35/132 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.