DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU2

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_180509.1 Gene:GSTU2 / 817497 AraportID:AT2G29480 Length:225 Species:Arabidopsis thaliana


Alignment Length:220 Identity:64/220 - (29%)
Similarity:99/220 - (45%) Gaps:42/220 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNP-QGKVPALEIVREPGPPVLT 85
            ::|......||::||.:.|..|.:||..:..:|..|...|||.|| ..|||.|    .....:|:
plant     8 VKLLGFWISPFSRRVEMALKLKGVPYEYLEEDLPKKSTLLLELNPVHKKVPVL----VHNDKLLS 68

  Fly    86 ESLLICEYLDEQYPLRPLYPRDPLKK---------VQDKLLIERFRAVLGAFFKASDGGD--LEP 139
            ||.:|.||:|:.:...|:.|.||.:|         |.:::|...|..::    ||..|.|  :|.
plant    69 ESHVILEYIDQTWNNNPILPHDPYEKAMVRFWAKFVDEQILPVGFMPLV----KAEKGIDVAIEE 129

  Fly   140 FWSGLDIYERELARRGTEFFGGEQTGILDYM---IWPWC--ERLELLKLQRGEDYNYDQSRFPQL 199
            ....|...|:|:.  |.:||||:..|.||.:   :.|:|  ...|.|    |.|.. .:..||:|
plant   130 IREMLMFLEKEVT--GKDFFGGKTIGFLDMVAGSMIPFCLARAWECL----GIDMT-PEDTFPEL 187

  Fly   200 TLWLERMKRDPAVMAFYMEAEVQAE 224
            ..|::.:.          |.|:..|
plant   188 NRWIKNLN----------EVEIVRE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 26/73 (36%)
GstA 22..215 CDD:223698 61/209 (29%)
GST_C_Omega 109..229 CDD:198293 33/132 (25%)
GSTU2NP_180509.1 GST_N_Tau 8..81 CDD:239356 27/76 (36%)
GstA 9..196 CDD:223698 61/211 (29%)
GST_C_Tau 91..217 CDD:198294 34/133 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.