DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GSTU7

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_180503.1 Gene:GSTU7 / 817491 AraportID:AT2G29420 Length:227 Species:Arabidopsis thaliana


Alignment Length:228 Identity:56/228 - (24%)
Similarity:107/228 - (46%) Gaps:39/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGKVPALEIVREPGPPVLTE 86
            ::|..|...||::|:.:.|..|.:.|..:..::|:|...||:.||..|:  :.::...|.|: :|
plant    10 VKLLGMWASPFSRRIEIALTLKGVSYEFLEQDITNKSSLLLQLNPVHKM--IPVLVHNGKPI-SE 71

  Fly    87 SLLICEYLDEQYPLRPLYPRDPLKK---------VQDKLLIERFRAVLGAFFKASDG-----GDL 137
            ||:|.||:||.:...|:.|:||.::         |.:::.:...: |:|...|..|.     .||
plant    72 SLVILEYIDETWRDNPILPQDPYERTMARFWSKFVDEQIYVTAMK-VVGKTGKERDAVVEATRDL 135

  Fly   138 EPFWSGLDIYERELARRGTEFFGGEQTGILDY---MIWPWCERLELL---KLQRGEDYNYDQSRF 196
                  |...|:||.  |.:|.||:..|.:|.   ::..|..|.|.:   |:...|       :|
plant   136 ------LMFLEKELV--GKDFLGGKSLGFVDIVATLVAFWLMRTEEIVGVKVVPVE-------KF 185

  Fly   197 PQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTR 229
            |::..|::.:..:..:.......:...:::|.|
plant   186 PEIHRWVKNLLGNDVIKKCIPPEDEHLKYIRAR 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 23/72 (32%)
GstA 22..215 CDD:223698 54/212 (25%)
GST_C_Omega 109..229 CDD:198293 26/139 (19%)
GSTU7NP_180503.1 GST_N_Tau 10..83 CDD:239356 25/75 (33%)
GstA 11..196 CDD:223698 54/203 (27%)
GST_C_Tau 93..218 CDD:198294 27/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 83 1.000 Inparanoid score I2350
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100366
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.