DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and gstr

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001038525.1 Gene:gstr / 564619 ZFINID:ZDB-GENE-090507-1 Length:226 Species:Danio rerio


Alignment Length:227 Identity:47/227 - (20%)
Similarity:90/227 - (39%) Gaps:44/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PFAQRVHLVLDAKQIPYHSIYINLTDKPEW----LLEKNPQGKVPALEIVREPGPPVLTESLLIC 91
            |...|:.:.|:.||:..:...:...||.|.    :...||:.::|..    :.|..|:.||...|
Zfish    14 PPCWRLMIALEEKQLQGYKHKLLSFDKKEHQSPEVKALNPRAQLPTF----KHGEIVVNESFAAC 74

  Fly    92 EYLDEQYPLR--PLYPRDP------------LKKVQDKLLIERFRAVL---GAFFKASDGGDLEP 139
            .||:..:..:  .|.|.:|            .:.:|.|:....|...|   |...:::...:.|.
Zfish    75 LYLESVFKSQGTRLIPDNPAEMALVYQRMFETENLQQKMYEVAFYDWLVPEGERLESALKRNKEK 139

  Fly   140 FWSGLDIYERELARRGT-EFFGGEQTGILDYMIWP---WCERLELLKLQRGEDYNYDQSRFPQLT 200
            ....|.::|..|.:.|. .:..|:...:.|.:.:|   :..||:..|           .|.|:|.
Zfish   140 LIEELKLWEGYLEKMGKGSYLAGKNFSMADVVCFPVIAYFPRLQCPK-----------ERCPRLM 193

  Fly   201 LWLERMKRDPAVMAF----YMEAEVQAEFLRT 228
            .:.|.:|..|::.|.    ::|..|..:.|::
Zfish   194 EYYEMVKDRPSIKASWPPEWLEKPVGEDILKS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 17/67 (25%)
GstA 22..215 CDD:223698 43/208 (21%)
GST_C_Omega 109..229 CDD:198293 26/131 (20%)
gstrNP_001038525.1 GstA 5..207 CDD:223698 43/207 (21%)
GST_N_family 5..78 CDD:238319 17/67 (25%)
GST_C_family 99..199 CDD:198286 20/110 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.