DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and clic5a

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001007386.1 Gene:clic5a / 492513 ZFINID:ZDB-GENE-041114-84 Length:246 Species:Danio rerio


Alignment Length:123 Identity:33/123 - (26%)
Similarity:50/123 - (40%) Gaps:15/123 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PDVP------EDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGKVPA 72
            ||:.      .||    .|:..|||:||:.::|..|.:.::...::|..||..|....|....|.
Zfish    10 PDIELFVKAGSDG----ESIGNCPFSQRLFMILWLKGVVFNVTTVDLKRKPADLHNLAPGTPPPF 70

  Fly    73 LEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAVLGAFFK 130
            |....|    |.|:...|.|:|:|.. ..|.||:...|..:.........|...|:.|
Zfish    71 LTFNGE----VRTDVNKIEEFLEEML-APPKYPKLAAKNKESNTAGNDIFAKFSAYIK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 24/86 (28%)
GstA 22..215 CDD:223698 29/109 (27%)
GST_C_Omega 109..229 CDD:198293 4/22 (18%)
clic5aNP_001007386.1 GST_N_CLIC 8..97 CDD:239359 27/95 (28%)
O-ClC 10..244 CDD:129941 33/123 (27%)
GST_C_CLIC5 104..244 CDD:198330 3/20 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.