DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and gsto2

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001005086.1 Gene:gsto2 / 448662 XenbaseID:XB-GENE-967227 Length:241 Species:Xenopus tropicalis


Alignment Length:238 Identity:93/238 - (39%)
Similarity:134/238 - (56%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGK 69
            :.||||||.|....:..:|:|||||||:|||..|||.||.|.:..|.|||.:||:|.:||:|.|.
 Frog     6 KSLAKGSPAPGPVSEETIRVYSMRFCPYAQRARLVLAAKGIKHEVININLKNKPDWFIEKSPFGL 70

  Fly    70 VPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAVLGAFFK---- 130
            ||:||   .....|:.||.::|:||||.||.:.|.|.||.:|.|.|:::|.|..:...|:|    
 Frog    71 VPSLE---TSSGQVIYESPIVCDYLDEVYPGKKLTPVDPFQKAQQKMIVEHFSKISTLFYKILLA 132

  Fly   131 ASDGGDLEPFWSGLDIYERE--------LARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGE 187
            ..:..|:    ||:....:|        ||::...||||....::|||||||.|||.:.      
 Frog   133 KKNNEDV----SGVKAEVQEKLVKLDEILAKQNGLFFGGSDVSMVDYMIWPWFERLIIF------ 187

  Fly   188 DYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRS 230
            |.....::.|.:..|.::|.:||||.|.|:|.::...|.:..|
 Frog   188 DSKDCLNKTPHIDKWYQQMLQDPAVKATYIEPDLLLGFFKLYS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 44/89 (49%)
GstA 22..215 CDD:223698 81/204 (40%)
GST_C_Omega 109..229 CDD:198293 39/131 (30%)
gsto2NP_001005086.1 GST_N_Omega 4..93 CDD:239353 44/89 (49%)
GST_C_Omega 107..229 CDD:198293 39/131 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8115
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I4074
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm9331
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.