DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and gsto1

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:240 Identity:106/240 - (44%)
Similarity:139/240 - (57%) Gaps:19/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LAKGSPMP-DVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGKV 70
            |.||||.| .||:|.| |||||||||||||..|||:||.|.|.:|.|||.:||:|.|||||.|.|
Zfish     8 LGKGSPAPGPVPKDHI-RLYSMRFCPFAQRTRLVLNAKGIKYDTININLKNKPDWFLEKNPLGLV 71

  Fly    71 PALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAVLGAFFK----A 131
            |.||  .:.| .|:.||.:.||||||.||.:.|.|.||.::.|.::|:|.|..|...|:|    .
Zfish    72 PVLE--TQSG-QVIYESPITCEYLDEVYPEKKLLPFDPFERAQQRMLLELFSKVTPYFYKIPVNR 133

  Fly   132 SDGGDLEPFWS----GLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYD 192
            :.|.|:....:    .|..:...|.::.::||||:...::|||:|||.||||.:.|:...|..  
Zfish   134 TKGEDVSALETELKDKLSQFNEILLKKKSKFFGGDSITMIDYMMWPWFERLETMNLKHCLDGT-- 196

  Fly   193 QSRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNYN 237
                |:|..|.|||..||.|.|.....|....|.::...|.|||:
Zfish   197 ----PELKKWTERMMEDPTVKATMFSTETYMVFYKSYMEGNPNYD 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 54/88 (61%)
GstA 22..215 CDD:223698 89/200 (45%)
GST_C_Omega 109..229 CDD:198293 39/127 (31%)
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 54/88 (61%)
GstA 25..210 CDD:223698 85/193 (44%)
GST_C_Omega 107..229 CDD:198293 39/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I7573
eggNOG 1 0.900 - - E1_KOG0406
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37971
Inparanoid 1 1.050 180 1.000 Inparanoid score I3986
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm6382
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - O PTHR43968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X130
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.