DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and Clic1

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_001002807.1 Gene:Clic1 / 406864 RGDID:1303043 Length:241 Species:Rattus norvegicus


Alignment Length:214 Identity:53/214 - (24%)
Similarity:80/214 - (37%) Gaps:56/214 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 CPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGKVPALEIVREPGPPVLTESLLICEYL 94
            |||:||:.:||..|.:.::...::...:.|.:.:..|.|::|.|..    |..|.|::..|.|:|
  Rat    24 CPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLY----GTEVHTDTNKIEEFL 84

  Fly    95 DEQYPLRPLYPRDPLKKVQDKLLIERFRAVLGAFFKASDGGDLEPFWSGLDIYERELARRGTEFF 159
             |.....|.||:                  |.|....|:       .|||||:.:..|     :.
  Rat    85 -EAVLCPPRYPK------------------LAALNPESN-------TSGLDIFAKFSA-----YI 118

  Fly   160 GGEQTGILDYMIWPWCERLE--LLKLQRGEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEAEVQ 222
            ......:.|        .||  |||..:..| ||..|..|:..  .|....|..:.        |
  Rat   119 KNSNPALND--------NLEKGLLKALKVLD-NYLTSPLPEEV--DETSAEDEGIS--------Q 164

  Fly   223 AEFLRTRSLGRPNYNLLVK 241
            .:||....|...:.|||.|
  Rat   165 RKFLDGNELTLADCNLLPK 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 18/64 (28%)
GstA 22..215 CDD:223698 45/186 (24%)
GST_C_Omega 109..229 CDD:198293 25/121 (21%)
Clic1NP_001002807.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..90 20/70 (29%)
O-ClC 6..241 CDD:129941 53/214 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.