DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment se and GstO2

DIOPT Version :9

Sequence 1:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:243 Identity:106/243 - (43%)
Similarity:152/243 - (62%) Gaps:6/243 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RHLAKGSPMPDVPEDGILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINLTDKPEWLLEKNPQGK 69
            :|..:||..|::||||:.|.:||.||||:.||.|:|.||.|.:|.||::|.:||||..:.:|.||
  Fly     6 KHFKRGSTKPELPEDGVPRFFSMAFCPFSHRVRLMLAAKHIEHHKIYVDLIEKPEWYKDFSPLGK 70

  Fly    70 VPALEIVREPGPPVLTESLLICEYLDEQYPLRPLYPRDPLKKVQDKLLIERFRAVLGAFFKASDG 134
            ||||::......|.|.|||:|.||||:|||...|:|.|||:|..||:|||||..|:.|.:.....
  Fly    71 VPALQLTGVKDQPTLVESLIIAEYLDQQYPQTRLFPTDPLQKALDKILIERFAPVVSAIYPVLTC 135

  Fly   135 GDLEP------FWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWCERLELLKLQRGEDYNYDQ 193
            ....|      |.:.||::|.||.:|||.:|.|:..||:|||||||.||...:|:...:.|..|.
  Fly   136 NPNAPKDAIPNFENALDVFEVELGKRGTPYFAGQHIGIVDYMIWPWFERFPSMKINTEQKYELDT 200

  Fly   194 SRFPQLTLWLERMKRDPAVMAFYMEAEVQAEFLRTRSLGRPNYNLLVK 241
            .||.:|..|.:.|.:|..|....::.::.|||.::::||.|.|::..|
  Fly   201 KRFEKLLKWRDLMTQDEVVQKTALDVQLHAEFQKSKTLGNPQYDIAFK 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 45/89 (51%)
GstA 22..215 CDD:223698 90/198 (45%)
GST_C_Omega 109..229 CDD:198293 47/125 (38%)
GstO2NP_729388.1 Thioredoxin_like 5..96 CDD:294274 45/89 (51%)
GstA 25..215 CDD:223698 87/189 (46%)
GST_C_Omega 110..235 CDD:198293 47/124 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449072
Domainoid 1 1.000 63 1.000 Domainoid score I3713
eggNOG 1 0.900 - - E1_KOG0406
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I3986
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48297
OrthoDB 1 1.010 - - D1225872at2759
OrthoFinder 1 1.000 - - FOG0001358
OrthoInspector 1 1.000 - - mtm6382
orthoMCL 1 0.900 - - OOG6_100366
Panther 1 1.100 - - P PTHR43968
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R16830
SonicParanoid 1 1.000 - - X130
1312.840

Return to query results.
Submit another query.